1. Английский язык
  2. We also went swimming with

We also went swimming with my friends and their mother. we swam together but not with my friends закончить рассказ

ncrfeed ncrfeed    1   02.08.2019 09:20    1

Ответы
stasya10687 stasya10687  30.09.2020 00:21
Are ill,so I can't go swimming alone.
ПОКАЗАТЬ ОТВЕТЫ
Другие вопросы по теме Английский язык
29082 29082  19.11.2020 11:17
Тапсырмалар: : 1.Complete the sentences with the words- Сөйлемді бір сөзбен толықтырa. Your dad s dad is yourb. Your mum s mum is yourc. Your mum s sister is yourd. Your dad s...
Komar1006 Komar1006  19.11.2020 11:17
1) i get up (get up) at seven o clock every day....
denishustov denishustov  19.11.2020 11:17
5 Complete the summary in 3 using items A-M from the wordlist below. Wordlist. A) in sequence. B) revolution. C) beneficial effect. D) much. E)messages, letters, electronics negative...
мад228 мад228  19.11.2020 11:17
Journey placetimereeffishwildlifecitycolourfulrareancientchallengingbrilliantmysteriouscoralcolourfulrareancientchallengingbrilliantmysteriouscoralНазадДалеечтобы получились словосочетания...
BellaNow BellaNow  19.11.2020 11:17
Кто выполнить с объяснениями?...
аза101 аза101  19.11.2020 11:17
in your country, Explain why it attracted your attention. Use Past Passive if possible. • had been announced that • This information had never been published • A lot of people...
Polly2011 Polly2011  19.11.2020 11:17
Переделать предложения в косвенную речь....
lolloo99 lolloo99  09.02.2021 16:08
True of False 1 Blenheim Palace is near the city of Oxford.2 It is the home of the Queen of England.3 The palace is set in five square kilometresof park and gardens.4 There is...
ARMY130613 ARMY130613  09.02.2021 16:08
Put special questions to the italicized words. В скобках количество вопросов. за выполнение. 1. I have seen Lisa three times in the last few days (3). 2. She has been ill since...
Makson3D Makson3D  09.02.2021 16:07
* Read the text again. Are the sentencestrue or false?The airport is in San Juan.false1 A guide is going to meet themat the hotel.2 There aren t any beaches in San Juan.3 On Tuesday...

Популярные вопросы