1. Английский язык
  2. 1.35 2 Read and listen

1.35 2 Read and listen to the text and answer the questions. 1 What is the name of the national park? 2 Where is it? 3 What is the landscape like? 4 What animals and plants do you find there? 5 What unusual sights can you see in the park? 6 What are some of the unusual animals and plants in the park?

Rinako12 Rinako12    3   29.11.2021 09:02    1

Ответы
Показать ответы (3)
Другие вопросы по теме Английский язык
leria11111111111 leria11111111111  19.11.2020 11:17
£100 million is almost/ nowhere near as much as €300 million. 2 Gold is a little / a lot more expensive than steel. 3 The Pacific Ocean is slightly /far bigger than the Arctic Ocean....
29082 29082  19.11.2020 11:17
Тапсырмалар: : 1.Complete the sentences with the words- Сөйлемді бір сөзбен толықтырa. Your dad s dad is yourb. Your mum s mum is yourc. Your mum s sister is yourd. Your dad s brother...
Komar1006 Komar1006  19.11.2020 11:17
1) i get up (get up) at seven o clock every day....
denishustov denishustov  19.11.2020 11:17
5 Complete the summary in 3 using items A-M from the wordlist below. Wordlist. A) in sequence. B) revolution. C) beneficial effect. D) much. E)messages, letters, electronics negative...
мад228 мад228  19.11.2020 11:17
Journey placetimereeffishwildlifecitycolourfulrareancientchallengingbrilliantmysteriouscoralcolourfulrareancientchallengingbrilliantmysteriouscoralНазадДалеечтобы получились словосочетания...
BellaNow BellaNow  19.11.2020 11:17
Кто выполнить с объяснениями?...
аза101 аза101  19.11.2020 11:17
in your country, Explain why it attracted your attention. Use Past Passive if possible. • had been announced that • This information had never been published • A lot of people had...
soffia242004 soffia242004  05.05.2022 01:25
I took a taxi to the station yesterday. He got up at 7 last Monday. написать отрицательную и вопросительную форму данных предложений...
gerad34343 gerad34343  04.05.2022 23:41
, БУДУ ОЧЕНЬ БЛАГОДАРНА‼️ текст и задания на фото....
msakinat msakinat  04.05.2022 23:00
в мене в профілі ще три таких питання, відповісте на всі і отримаєте ів. Напишіть ,будь ласка, імеіл за цією темою. (пишіть якщо не складно в текстовому документі, а не на папері)...

Популярные вопросы